GALE purified MaxPab mouse polyclonal antibody (B01P)
  • GALE purified MaxPab mouse polyclonal antibody (B01P)

GALE purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002582-B01P
GALE purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GALE protein.
Información adicional
Size 50 ug
Gene Name GALE
Gene Alias FLJ95174|FLJ97302|SDR1E1
Gene Description UDP-galactose-4-epimerase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALE (NP_000394.2, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2582

Enviar uma mensagem


GALE purified MaxPab mouse polyclonal antibody (B01P)

GALE purified MaxPab mouse polyclonal antibody (B01P)