GALC purified MaxPab rabbit polyclonal antibody (D01P)
  • GALC purified MaxPab rabbit polyclonal antibody (D01P)

GALC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002581-D01P
GALC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GALC protein.
Información adicional
Size 100 ug
Gene Name GALC
Gene Alias -
Gene Description galactosylceramidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALC (AAH36518.1, 1 a.a. ~ 669 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2581

Enviar uma mensagem


GALC purified MaxPab rabbit polyclonal antibody (D01P)

GALC purified MaxPab rabbit polyclonal antibody (D01P)