GAK MaxPab rabbit polyclonal antibody (D01)
  • GAK MaxPab rabbit polyclonal antibody (D01)

GAK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002580-D01
GAK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GAK protein.
Información adicional
Size 100 uL
Gene Name GAK
Gene Alias FLJ16629|FLJ40395|MGC99654
Gene Description cyclin G associated kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSSPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQPRPNYA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GAK (AAH08668.1, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2580

Enviar uma mensagem


GAK MaxPab rabbit polyclonal antibody (D01)

GAK MaxPab rabbit polyclonal antibody (D01)