GABRE monoclonal antibody (M01A), clone 1G11 View larger

Mouse monoclonal antibody raised against a partial recombinant GABRE.

AB-H00002564-M01A

New product

GABRE monoclonal antibody (M01A), clone 1G11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 200 uL
Gene Name GABRE
Gene Alias -
Gene Description gamma-aminobutyric acid (GABA) A receptor, epsilon
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLSKVLPVFLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GABRE (AAH59376.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2564
Clone Number 1G11
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GABRE.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GABRE.

Mouse monoclonal antibody raised against a partial recombinant GABRE.