GABRE monoclonal antibody (M01), clone 1G11
  • GABRE monoclonal antibody (M01), clone 1G11

GABRE monoclonal antibody (M01), clone 1G11

Ref: AB-H00002564-M01
GABRE monoclonal antibody (M01), clone 1G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GABRE.
Información adicional
Size 50 ug
Gene Name GABRE
Gene Alias -
Gene Description gamma-aminobutyric acid (GABA) A receptor, epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLSKVLPVFLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GABRE (AAH59376.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2564
Clone Number 1G11
Iso type IgG2a Kappa

Enviar uma mensagem


GABRE monoclonal antibody (M01), clone 1G11

GABRE monoclonal antibody (M01), clone 1G11