GABBR1 monoclonal antibody (M01J), clone 2D7
  • GABBR1 monoclonal antibody (M01J), clone 2D7

GABBR1 monoclonal antibody (M01J), clone 2D7

Ref: AB-H00002550-M01J
GABBR1 monoclonal antibody (M01J), clone 2D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GABBR1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name GABBR1
Gene Alias FLJ92613|GABAB(1e)|GABABR1|GABBR1-3|GPRC3A|dJ271M21.1.1|dJ271M21.1.2|hGB1a
Gene Description gamma-aminobutyric acid (GABA) B receptor, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GABBR1 (AAH50532.2, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2550
Clone Number 2D7
Iso type IgG2a Kappa

Enviar uma mensagem


GABBR1 monoclonal antibody (M01J), clone 2D7

GABBR1 monoclonal antibody (M01J), clone 2D7