GAA monoclonal antibody (M01), clone 3C6
  • GAA monoclonal antibody (M01), clone 3C6

GAA monoclonal antibody (M01), clone 3C6

Ref: AB-H00002548-M01
GAA monoclonal antibody (M01), clone 3C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GAA.
Información adicional
Size 100 ug
Gene Name GAA
Gene Alias LYAG
Gene Description glucosidase, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GAA (AAH40431, 851 a.a. ~ 952 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2548
Clone Number 3C6
Iso type IgG1 Kappa

Enviar uma mensagem


GAA monoclonal antibody (M01), clone 3C6

GAA monoclonal antibody (M01), clone 3C6