FUT7 monoclonal antibody (M05), clone 1A12
  • FUT7 monoclonal antibody (M05), clone 1A12

FUT7 monoclonal antibody (M05), clone 1A12

Ref: AB-H00002529-M05
FUT7 monoclonal antibody (M05), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FUT7.
Información adicional
Size 100 ug
Gene Name FUT7
Gene Alias FucT-VII
Gene Description fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FUT7 (NP_004470, 262 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2529
Clone Number 1A12
Iso type IgG2a Kappa

Enviar uma mensagem


FUT7 monoclonal antibody (M05), clone 1A12

FUT7 monoclonal antibody (M05), clone 1A12