FUT2 monoclonal antibody (M02), clone 4C12
  • FUT2 monoclonal antibody (M02), clone 4C12

FUT2 monoclonal antibody (M02), clone 4C12

Ref: AB-H00002524-M02
FUT2 monoclonal antibody (M02), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FUT2.
Información adicional
Size 100 ug
Gene Name FUT2
Gene Alias SE|SEC2|Se2|sej
Gene Description fucosyltransferase 2 (secretor status included)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FUT2 (NP_000502, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2524
Clone Number 4C12
Iso type IgG2a Kappa

Enviar uma mensagem


FUT2 monoclonal antibody (M02), clone 4C12

FUT2 monoclonal antibody (M02), clone 4C12