FUT1 MaxPab mouse polyclonal antibody (B01)
  • FUT1 MaxPab mouse polyclonal antibody (B01)

FUT1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00002523-B01
FUT1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human FUT1 protein.
Información adicional
Size 50 uL
Gene Name FUT1
Gene Alias H|HH|HSC
Gene Description fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FUT1 (NP_000139.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2523

Enviar uma mensagem


FUT1 MaxPab mouse polyclonal antibody (B01)

FUT1 MaxPab mouse polyclonal antibody (B01)