FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)

FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002519-D01P
FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FUCA2 protein.
Información adicional
Size 100 ug
Gene Name FUCA2
Gene Alias MGC1314|dJ20N2.5
Gene Description fucosidase, alpha-L- 2, plasma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FUCA2 (AAH03060.1, 1 a.a. ~ 467 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2519

Enviar uma mensagem


FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)

FUCA2 purified MaxPab rabbit polyclonal antibody (D01P)