FSHR polyclonal antibody (A01)
  • FSHR polyclonal antibody (A01)

FSHR polyclonal antibody (A01)

Ref: AB-H00002492-A01
FSHR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FSHR.
Información adicional
Size 50 uL
Gene Name FSHR
Gene Alias FSHRO|LGR1|MGC141667|MGC141668|ODG1
Gene Description follicle stimulating hormone receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FSHR (NP_000136, 18 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2492

Enviar uma mensagem


FSHR polyclonal antibody (A01)

FSHR polyclonal antibody (A01)