FRZB monoclonal antibody (M02), clone 4E5 View larger

Mouse monoclonal antibody raised against a full-length recombinant FRZB.

AB-H00002487-M02

New product

FRZB monoclonal antibody (M02), clone 4E5

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FRZB
Gene Alias FRE|FRITZ|FRP-3|FRZB-1|FRZB-PEN|FRZB1|FZRB|SFRP3|SRFP3|hFIZ
Gene Description frizzled-related protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FRZB (NP_001454, 102 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2487
Clone Number 4E5
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant FRZB.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant FRZB.

Mouse monoclonal antibody raised against a full-length recombinant FRZB.