FXN purified MaxPab rabbit polyclonal antibody (D01P)
  • FXN purified MaxPab rabbit polyclonal antibody (D01P)

FXN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002395-D01P
FXN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FXN protein.
Información adicional
Size 100 ug
Gene Name FXN
Gene Alias CyaY|FA|FARR|FRDA|MGC57199|X25
Gene Description frataxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2395

Enviar uma mensagem


FXN purified MaxPab rabbit polyclonal antibody (D01P)

FXN purified MaxPab rabbit polyclonal antibody (D01P)