FOS monoclonal antibody (M61), clone 1H8
  • FOS monoclonal antibody (M61), clone 1H8

FOS monoclonal antibody (M61), clone 1H8

Ref: AB-H00002353-M61
FOS monoclonal antibody (M61), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FOS.
Información adicional
Size 100 ug
Gene Name FOS
Gene Alias AP-1|C-FOS
Gene Description v-fos FBJ murine osteosarcoma viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOS (NP_005243.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2353
Clone Number 1H8
Iso type IgG2a Kappa

Enviar uma mensagem


FOS monoclonal antibody (M61), clone 1H8

FOS monoclonal antibody (M61), clone 1H8