FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)

FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002352-D01P
FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FOLR3 protein.
Información adicional
Size 100 ug
Gene Name FOLR3
Gene Alias FR-G|FR-gamma|gamma-hFR
Gene Description folate receptor 3 (gamma)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOLR3 (AAI48786.1, 1 a.a. ~ 245 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2352

Enviar uma mensagem


FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)

FOLR3 purified MaxPab rabbit polyclonal antibody (D01P)