FNTA purified MaxPab mouse polyclonal antibody (B02P)
  • FNTA purified MaxPab mouse polyclonal antibody (B02P)

FNTA purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002339-B02P
FNTA purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FNTA protein.
Información adicional
Size 50 ug
Gene Name FNTA
Gene Alias FPTA|MGC99680|PGGT1A|PTAR2
Gene Description farnesyltransferase, CAAX box, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSCTVRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQLVISFTCSFVTNMFACLPYLRHWGYSRSRSYPMELKEDRVLSGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FNTA (AAH37295.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2339

Enviar uma mensagem


FNTA purified MaxPab mouse polyclonal antibody (B02P)

FNTA purified MaxPab mouse polyclonal antibody (B02P)