FMOD purified MaxPab mouse polyclonal antibody (B01P)
  • FMOD purified MaxPab mouse polyclonal antibody (B01P)

FMOD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002331-B01P
FMOD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FMOD protein.
Información adicional
Size 50 ug
Gene Name FMOD
Gene Alias SLRR2E
Gene Description fibromodulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQWISLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FMOD (AAH35281, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2331

Enviar uma mensagem


FMOD purified MaxPab mouse polyclonal antibody (B01P)

FMOD purified MaxPab mouse polyclonal antibody (B01P)