FMO3 purified MaxPab rabbit polyclonal antibody (D01P)
  • FMO3 purified MaxPab rabbit polyclonal antibody (D01P)

FMO3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002328-D01P
FMO3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FMO3 protein.
Información adicional
Size 100 ug
Gene Name FMO3
Gene Alias FMOII|MGC34400|TMAU|dJ127D3.1
Gene Description flavin containing monooxygenase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FMO3 (AAH32016.1, 1 a.a. ~ 532 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2328

Enviar uma mensagem


FMO3 purified MaxPab rabbit polyclonal antibody (D01P)

FMO3 purified MaxPab rabbit polyclonal antibody (D01P)