FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)
  • FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002323-D01P
FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FLT3LG protein.
Información adicional
Size 100 ug
Gene Name FLT3LG
Gene Alias FL
Gene Description fms-related tyrosine kinase 3 ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLT3LG (NP_001450.2, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2323

Enviar uma mensagem


FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)

FLT3LG purified MaxPab rabbit polyclonal antibody (D01P)