FLT1 purified MaxPab mouse polyclonal antibody (B01P)
  • FLT1 purified MaxPab mouse polyclonal antibody (B01P)

FLT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002321-B01P
FLT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FLT1 protein.
Información adicional
Size 50 ug
Gene Name FLT1
Gene Alias FLT|VEGFR1
Gene Description fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTAT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLT1 (AAH39007.1, 1 a.a. ~ 687 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2321

Enviar uma mensagem


FLT1 purified MaxPab mouse polyclonal antibody (B01P)

FLT1 purified MaxPab mouse polyclonal antibody (B01P)