FOXC2 monoclonal antibody (M01), clone 3H3
  • FOXC2 monoclonal antibody (M01), clone 3H3

FOXC2 monoclonal antibody (M01), clone 3H3

Ref: AB-H00002303-M01
FOXC2 monoclonal antibody (M01), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FOXC2.
Información adicional
Size 100 ug
Gene Name FOXC2
Gene Alias FKHL14|LD|MFH-1|MFH1
Gene Description forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2303
Clone Number 3H3
Iso type IgG2b Lambda

Enviar uma mensagem


FOXC2 monoclonal antibody (M01), clone 3H3

FOXC2 monoclonal antibody (M01), clone 3H3