FOXD1 DNAxPab View larger

Rabbit polyclonal antibody raised against a full-length human FOXD1 DNA using DNAx™ Immune technology.

AB-H00002297-W01P

New product

FOXD1 DNAxPab

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name FOXD1
Gene Alias FKHL8|FREAC4
Gene Description forkhead box D1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAAAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOXD1 (AAI60026.1, 1 a.a. ~ 465 a.a) full-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2297

More info

Rabbit polyclonal antibody raised against a full-length human FOXD1 DNA using DNAx™ Immune technology.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human FOXD1 DNA using DNAx™ Immune technology.

Rabbit polyclonal antibody raised against a full-length human FOXD1 DNA using DNAx™ Immune technology.