FKBP4 monoclonal antibody (M01), clone 5C11
  • FKBP4 monoclonal antibody (M01), clone 5C11

FKBP4 monoclonal antibody (M01), clone 5C11

Ref: AB-H00002288-M01
FKBP4 monoclonal antibody (M01), clone 5C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FKBP4.
Información adicional
Size 100 ug
Gene Name FKBP4
Gene Alias FKBP52|FKBP59|HBI|Hsp56|PPIase|p52
Gene Description FK506 binding protein 4, 59kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2288
Clone Number 5C11
Iso type IgG2a Kappa

Enviar uma mensagem


FKBP4 monoclonal antibody (M01), clone 5C11

FKBP4 monoclonal antibody (M01), clone 5C11