FKBP1B monoclonal antibody (M01), clone 4H5-1B6
  • FKBP1B monoclonal antibody (M01), clone 4H5-1B6

FKBP1B monoclonal antibody (M01), clone 4H5-1B6

Ref: AB-H00002281-M01
FKBP1B monoclonal antibody (M01), clone 4H5-1B6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FKBP1B.
Información adicional
Size 100 ug
Gene Name FKBP1B
Gene Alias FKBP12.6|FKBP1L|OTK4|PKBP1L|PPIase
Gene Description FK506 binding protein 1B, 12.6 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP1B (AAH02614, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2281
Clone Number 4H5-1B6
Iso type IgG1 kappa

Enviar uma mensagem


FKBP1B monoclonal antibody (M01), clone 4H5-1B6

FKBP1B monoclonal antibody (M01), clone 4H5-1B6