FKBP1A monoclonal antibody (M01J), clone 1E5-A12
  • FKBP1A monoclonal antibody (M01J), clone 1E5-A12

FKBP1A monoclonal antibody (M01J), clone 1E5-A12

Ref: AB-H00002280-M01J
FKBP1A monoclonal antibody (M01J), clone 1E5-A12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant FKBP1A.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name FKBP1A
Gene Alias FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE
Gene Description FK506 binding protein 1A, 12kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2280
Clone Number 1E5-A12
Iso type IgG1 Kappa

Enviar uma mensagem


FKBP1A monoclonal antibody (M01J), clone 1E5-A12

FKBP1A monoclonal antibody (M01J), clone 1E5-A12