View larger
Mouse monoclonal antibody raised against a full length recombinant FKBP1A.
AB-H00002280-M01
New product
FKBP1A monoclonal antibody (M01), clone 1E5-A12
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FKBP1A |
| Gene Alias | FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE |
| Gene Description | FK506 binding protein 1A, 12kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2280 |
| Clone Number | 1E5-A12 |
| Iso type | IgG1 kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant FKBP1A.