FGL1 monoclonal antibody (M01), clone 2A4
  • FGL1 monoclonal antibody (M01), clone 2A4

FGL1 monoclonal antibody (M01), clone 2A4

Ref: AB-H00002267-M01
FGL1 monoclonal antibody (M01), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FGL1.
Información adicional
Size 100 ug
Gene Name FGL1
Gene Alias HFREP1|HP-041|LFIRE1|MGC12455
Gene Description fibrinogen-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGL1 (AAH07047.1, 19 a.a. ~ 312 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2267
Clone Number 2A4
Iso type IgG2b Kappa

Enviar uma mensagem


FGL1 monoclonal antibody (M01), clone 2A4

FGL1 monoclonal antibody (M01), clone 2A4