FGG monoclonal antibody (M01J), clone 1F2
  • FGG monoclonal antibody (M01J), clone 1F2

FGG monoclonal antibody (M01J), clone 1F2

Ref: AB-H00002266-M01J
FGG monoclonal antibody (M01J), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FGG.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name FGG
Gene Alias -
Gene Description fibrinogen gamma chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2266
Clone Number 1F2
Iso type IgG1 Kappa

Enviar uma mensagem


FGG monoclonal antibody (M01J), clone 1F2

FGG monoclonal antibody (M01J), clone 1F2