GPC5 purified MaxPab mouse polyclonal antibody (B01P)
  • GPC5 purified MaxPab mouse polyclonal antibody (B01P)

GPC5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002262-B01P
GPC5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPC5 protein.
Información adicional
Size 50 ug
Gene Name GPC5
Gene Alias -
Gene Description glypican 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSRALLKM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPC5 (NP_004457.1, 1 a.a. ~ 572 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2262

Enviar uma mensagem


GPC5 purified MaxPab mouse polyclonal antibody (B01P)

GPC5 purified MaxPab mouse polyclonal antibody (B01P)