FGF14 polyclonal antibody (A01)
  • FGF14 polyclonal antibody (A01)

FGF14 polyclonal antibody (A01)

Ref: AB-H00002259-A01
FGF14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FGF14.
Información adicional
Size 50 uL
Gene Name FGF14
Gene Alias FHF4|MGC119129|SCA27
Gene Description fibroblast growth factor 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF14 (NP_004106, 138 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2259

Enviar uma mensagem


FGF14 polyclonal antibody (A01)

FGF14 polyclonal antibody (A01)