FGF9 polyclonal antibody (A01)
  • FGF9 polyclonal antibody (A01)

FGF9 polyclonal antibody (A01)

Ref: AB-H00002254-A01
FGF9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FGF9.
Información adicional
Size 50 uL
Gene Name FGF9
Gene Alias GAF|HBFG-9|MGC119914|MGC119915
Gene Description fibroblast growth factor 9 (glia-activating factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF9 (NP_002001, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2254

Enviar uma mensagem


FGF9 polyclonal antibody (A01)

FGF9 polyclonal antibody (A01)