FGF8 monoclonal antibody (M06), clone 3H2
  • FGF8 monoclonal antibody (M06), clone 3H2

FGF8 monoclonal antibody (M06), clone 3H2

Ref: AB-H00002253-M06
FGF8 monoclonal antibody (M06), clone 3H2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FGF8.
Información adicional
Size 100 ug
Gene Name FGF8
Gene Alias AIGF|HBGF-8|MGC149376
Gene Description fibroblast growth factor 8 (androgen-induced)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2253
Clone Number 3H2
Iso type IgG2a Kappa

Enviar uma mensagem


FGF8 monoclonal antibody (M06), clone 3H2

FGF8 monoclonal antibody (M06), clone 3H2