FES monoclonal antibody (M01), clone 3A3-1E5
  • FES monoclonal antibody (M01), clone 3A3-1E5

FES monoclonal antibody (M01), clone 3A3-1E5

Ref: AB-H00002242-M01
FES monoclonal antibody (M01), clone 3A3-1E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant FES.
Información adicional
Size 100 ug
Gene Name FES
Gene Alias FPS
Gene Description feline sarcoma oncogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FES (AAH35357, 1 a.a. ~ 822 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2242
Clone Number 3A3-1E5
Iso type IgG1 kappa

Enviar uma mensagem


FES monoclonal antibody (M01), clone 3A3-1E5

FES monoclonal antibody (M01), clone 3A3-1E5