FES purified MaxPab mouse polyclonal antibody (B01P)
  • FES purified MaxPab mouse polyclonal antibody (B01P)

FES purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002242-B01P
FES purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FES protein.
Información adicional
Size 50 ug
Gene Name FES
Gene Alias FPS
Gene Description feline sarcoma oncogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FES (ABM85456.1, 1 a.a. ~ 822 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2242

Enviar uma mensagem


FES purified MaxPab mouse polyclonal antibody (B01P)

FES purified MaxPab mouse polyclonal antibody (B01P)