FECH monoclonal antibody (M07), clone 3H3
  • FECH monoclonal antibody (M07), clone 3H3

FECH monoclonal antibody (M07), clone 3H3

Ref: AB-H00002235-M07
FECH monoclonal antibody (M07), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FECH.
Información adicional
Size 100 ug
Gene Name FECH
Gene Alias EPP|FCE
Gene Description ferrochelatase (protoporphyria)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FECH (NP_000131, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2235
Clone Number 3H3
Iso type IgG2b Kappa

Enviar uma mensagem


FECH monoclonal antibody (M07), clone 3H3

FECH monoclonal antibody (M07), clone 3H3