FDPS monoclonal antibody (M01), clone 3A6
  • FDPS monoclonal antibody (M01), clone 3A6

FDPS monoclonal antibody (M01), clone 3A6

Ref: AB-H00002224-M01
FDPS monoclonal antibody (M01), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FDPS.
Información adicional
Size 100 ug
Gene Name FDPS
Gene Alias FPPS|FPS
Gene Description farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FDPS (NP_001995.1, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2224
Clone Number 3A6
Iso type IgG2a Kappa

Enviar uma mensagem


FDPS monoclonal antibody (M01), clone 3A6

FDPS monoclonal antibody (M01), clone 3A6