View larger
Mouse monoclonal antibody raised against a partial recombinant FCGR2B.
AB-H00002213-M02A
New product
FCGR2B monoclonal antibody (M02A), clone 1A9
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | FCGR2B |
| Gene Alias | CD32|CD32B|FCG2|FCGR2|IGFR2 |
| Gene Description | Fc fragment of IgG, low affinity IIb, receptor (CD32) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,ELISA |
| Immunogen Prot. Seq | AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 2213 |
| Clone Number | 1A9 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant FCGR2B.