FCGR1A purified MaxPab mouse polyclonal antibody (B01P)
  • FCGR1A purified MaxPab mouse polyclonal antibody (B01P)

FCGR1A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002209-B01P
FCGR1A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FCGR1A protein.
Información adicional
Size 50 ug
Gene Name FCGR1A
Gene Alias CD64|CD64A|FCRI|FLJ18345|IGFR1
Gene Description Fc fragment of IgG, high affinity Ia, receptor (CD64)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FCGR1A (NP_000557.1, 1 a.a. ~ 374 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2209

Enviar uma mensagem


FCGR1A purified MaxPab mouse polyclonal antibody (B01P)

FCGR1A purified MaxPab mouse polyclonal antibody (B01P)