MS4A2 monoclonal antibody (M02), clone 3B1
  • MS4A2 monoclonal antibody (M02), clone 3B1

MS4A2 monoclonal antibody (M02), clone 3B1

Ref: AB-H00002206-M02
MS4A2 monoclonal antibody (M02), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MS4A2.
Información adicional
Size 100 ug
Gene Name MS4A2
Gene Alias APY|ATOPY|FCER1B|FCERI|IGEL|IGER|IGHER|MS4A1
Gene Description membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MS4A2 (NP_000130, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2206
Clone Number 3B1
Iso type IgG2a Kappa

Enviar uma mensagem


MS4A2 monoclonal antibody (M02), clone 3B1

MS4A2 monoclonal antibody (M02), clone 3B1