FBP1 polyclonal antibody (A01)
  • FBP1 polyclonal antibody (A01)

FBP1 polyclonal antibody (A01)

Ref: AB-H00002203-A01
FBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FBP1.
Información adicional
Size 50 uL
Gene Name FBP1
Gene Alias FBP
Gene Description fructose-1,6-bisphosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBP1 (AAH12927.1, 1 a.a. ~ 338 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2203

Enviar uma mensagem


FBP1 polyclonal antibody (A01)

FBP1 polyclonal antibody (A01)