FAU monoclonal antibody (M03), clone 3C10
  • FAU monoclonal antibody (M03), clone 3C10

FAU monoclonal antibody (M03), clone 3C10

Ref: AB-H00002197-M03
FAU monoclonal antibody (M03), clone 3C10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant FAU.
Información adicional
Size 100 ug
Gene Name FAU
Gene Alias FAU1|FLJ22986|Fub1|Fubi|MNSFbeta|RPS30
Gene Description Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAU (AAH33877, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2197
Clone Number 3C10
Iso type IgG2a Kappa

Enviar uma mensagem


FAU monoclonal antibody (M03), clone 3C10

FAU monoclonal antibody (M03), clone 3C10