FASN purified MaxPab rabbit polyclonal antibody (D01P)
  • FASN purified MaxPab rabbit polyclonal antibody (D01P)

FASN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002194-D01P
FASN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FASN protein.
Información adicional
Size 100 ug
Gene Name FASN
Gene Alias FAS|MGC14367|MGC15706|OA-519|SDR27X1
Gene Description fatty acid synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FASN (AAH07909.1, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2194

Enviar uma mensagem


FASN purified MaxPab rabbit polyclonal antibody (D01P)

FASN purified MaxPab rabbit polyclonal antibody (D01P)