FANCG purified MaxPab mouse polyclonal antibody (B01P)
  • FANCG purified MaxPab mouse polyclonal antibody (B01P)

FANCG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002189-B01P
FANCG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FANCG protein.
Información adicional
Size 50 ug
Gene Name FANCG
Gene Alias FAG|XRCC9
Gene Description Fanconi anemia, complementation group G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCG (NP_004620.1, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2189

Enviar uma mensagem


FANCG purified MaxPab mouse polyclonal antibody (B01P)

FANCG purified MaxPab mouse polyclonal antibody (B01P)