FANCC purified MaxPab rabbit polyclonal antibody (D01P)
  • FANCC purified MaxPab rabbit polyclonal antibody (D01P)

FANCC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002176-D01P
FANCC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FANCC protein.
Información adicional
Size 100 ug
Gene Name FANCC
Gene Alias FA3|FAC|FACC|FLJ14675
Gene Description Fanconi anemia, complementation group C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAML
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FANCC (NP_000127.2, 1 a.a. ~ 558 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2176

Enviar uma mensagem


FANCC purified MaxPab rabbit polyclonal antibody (D01P)

FANCC purified MaxPab rabbit polyclonal antibody (D01P)