F11 purified MaxPab rabbit polyclonal antibody (D01P)
  • F11 purified MaxPab rabbit polyclonal antibody (D01P)

F11 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002160-D01P
F11 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human F11 protein.
Información adicional
Size 100 ug
Gene Name F11
Gene Alias FXI|MGC141891
Gene Description coagulation factor XI
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen F11 (NP_000119.1, 1 a.a. ~ 625 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2160

Enviar uma mensagem


F11 purified MaxPab rabbit polyclonal antibody (D01P)

F11 purified MaxPab rabbit polyclonal antibody (D01P)