EXT2 monoclonal antibody (M01), clone 3G6
  • EXT2 monoclonal antibody (M01), clone 3G6

EXT2 monoclonal antibody (M01), clone 3G6

Ref: AB-H00002132-M01
EXT2 monoclonal antibody (M01), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EXT2.
Información adicional
Size 100 ug
Gene Name EXT2
Gene Alias SOTV
Gene Description exostoses (multiple) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GFSTWTYRQGYDVSIPVYSPLSAEVDLPEKGPGPRQYFLLSSQVGLHPEYREDLEALQVKHGESVLVLDKCTNLSEGVLSVRKRCHKHQVFDYPQVLQEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXT2 (AAH10058, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2132
Clone Number 3G6
Iso type IgG1 kappa

Enviar uma mensagem


EXT2 monoclonal antibody (M01), clone 3G6

EXT2 monoclonal antibody (M01), clone 3G6