EVI2B monoclonal antibody (M02), clone 2G9
  • EVI2B monoclonal antibody (M02), clone 2G9

EVI2B monoclonal antibody (M02), clone 2G9

Ref: AB-H00002124-M02
EVI2B monoclonal antibody (M02), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EVI2B.
Información adicional
Size 100 ug
Gene Name EVI2B
Gene Alias D17S376|EVDB
Gene Description ecotropic viral integration site 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVI2B (NP_006486, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2124
Clone Number 2G9
Iso type IgG2b Kappa

Enviar uma mensagem


EVI2B monoclonal antibody (M02), clone 2G9

EVI2B monoclonal antibody (M02), clone 2G9