EVI2B polyclonal antibody (A01)
  • EVI2B polyclonal antibody (A01)

EVI2B polyclonal antibody (A01)

Ref: AB-H00002124-A01
EVI2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EVI2B.
Información adicional
Size 50 uL
Gene Name EVI2B
Gene Alias D17S376|EVDB
Gene Description ecotropic viral integration site 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVI2B (NP_006486, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2124

Enviar uma mensagem


EVI2B polyclonal antibody (A01)

EVI2B polyclonal antibody (A01)