EVI2A purified MaxPab mouse polyclonal antibody (B01P)
  • EVI2A purified MaxPab mouse polyclonal antibody (B01P)

EVI2A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002123-B01P
EVI2A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EVI2A protein.
Información adicional
Size 50 ug
Gene Name EVI2A
Gene Alias EVDA|EVI2
Gene Description ecotropic viral integration site 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EVI2A (AAH35572, 25 a.a. ~ 236 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2123

Enviar uma mensagem


EVI2A purified MaxPab mouse polyclonal antibody (B01P)

EVI2A purified MaxPab mouse polyclonal antibody (B01P)